PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04274.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 336aa    MW: 38343.5 Da    PI: 7.8454
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04274.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-55211481129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdee++++yLk+kv ++++ +  ++ e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkat
  Rsa1.0_04274.1_g00001.1  21 LPPGFRFHPTDEEIITFYLKEKVLDSRFMA-VAMGEADLNKCEPWDLPKRAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKAT 105
                              79*************************888.67***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ kg lvg+kktLvfy+grap+gekt+Wvmheyrle
  Rsa1.0_04274.1_g00001.1 106 GKDKEIFKGKGCLVGMKKTLVFYRGRAPRGEKTNWVMHEYRLE 148
                              ********9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6316173IPR003441NAC domain
PROSITE profilePS5100558.61221172IPR003441NAC domain
PfamPF023653.3E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAVVVEEGVV LNHGGAELVG LPPGFRFHPT DEEIITFYLK EKVLDSRFMA VAMGEADLNK  60
CEPWDLPKRA KMGEKEFYFF CQRDRKYPTG MRTNRATESG YWKATGKDKE IFKGKGCLVG  120
MKKTLVFYRG RAPRGEKTNW VMHEYRLEGK YSYHKLPKSA RDEWVVCRVF HKNNPSTTTQ  180
QTTRIPIKNL TRMDSLENID HLLAFSSLPP LMDPSFTDQH DQHNFKPINP PTYDISSPIQ  240
PHHFNSNYQS IFNHQGYGSA SGSGSTYNNH KEMIKMEQSL VSVSQETCLS SDVNATTTTE  300
VSSGPVMKQE MSMTGMVNCS KSYEDLCDLR GILWDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-501917413170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413570.0KP641357.1 Brassica napus NAC transcription factor 87.1 (NAC87.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013676077.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ21e-94NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A078IQ480.0A0A078IQ48_BRANA; BnaA02g04040D protein
STRINGBra023669.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.10.0Arabidopsis NAC domain containing protein 87